SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RN80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RN80
Domain Number 1 Region: 18-157
Classification Level Classification E-value
Superfamily Cyclin-like 3.59e-42
Family Cyclin 0.000000117
Further Details:      
 
Domain Number 2 Region: 158-265
Classification Level Classification E-value
Superfamily Cyclin-like 1.79e-33
Family Cyclin 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RN80
Sequence length 588
Comment (tr|E2RN80|E2RN80_CANLF) Cyclin K {ECO:0000313|Ensembl:ENSCAFP00000026305} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNK OC=Canis.
Sequence
MKENKENSSPSVTSANLDHTKPCWYWDKKDLAHTPSQLEGLDPATEARYRREGARFIFDV
GTRLGLHYDTLATGIIYFHRFYMFHSFKQFPRYVTGACCLFLAGKVEETPKKCKDIIKTA
RSLLNDVQFGQFGDDPKEEVMVLERILLQTIKFDLQVEHPYQFLLKYAKQLKGDKNKIQK
LVQMAWTFVNDRTSLCTTLSLQWEPEIIAVAVMYLAGRLCKFEIQEWTSKPMYRRWWEQF
VQDVPVDVLEDICHQILDLYSQGKQQMPHHTPHQLQQPPPLQSTPQVPQVPPPQPAQGSD
PPQPPQKDSQPPAPQPPPQQAPQPKKPSPQPSPPRPAKRAVVVSPKEENKAAEPPPPKIP
KIETTHPPLPPAHPPPARVPPITFLFASASTDPPAPVPRGCAEKRCGVLGSPAHTWPMCA
SGTIGPQPCPGAQTDFPVGMSVGPSDLGGRAGQSLQSMMKTEGPSYGALPPAYGPPAHLP
YHPHVYPPNPPPPPVPPPPASFPPPAIPPPTPGYPPPPPTYNPNFPPPPPRLPPTHAVPP
HPPPGLGLPPASYPPPAVPPGGQPPVPPPIPPPGMPPVGGLGRAAWMR
Download sequence
Identical sequences E2RN80
ENSCAFP00000026305 ENSCAFP00000026305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]