SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RNM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RNM4
Domain Number 1 Region: 148-220
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000889
Family Pyk2-associated protein beta ARF-GAP domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RNM4
Sequence length 653
Comment (tr|E2RNM4|E2RNM4_CANLF) ArfGAP with FG repeats 1 {ECO:0000313|Ensembl:ENSCAFP00000015346} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=AGFG1 OC=Canis.
Sequence
MAEISRIQYEMEYTEGISQQMRVPEKLKVAPPNADLEQGFQEGVPNASVIMQVPERIVVA
GNNEDIPFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPPTPQNEEIRA
VGRLKRERSMSENAVRQNGQLVRADSMRGLNPPHRVKSISMTTFTQQEIEFLQKHGNEVC
KQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSAS
STSSTPEVKPLKSLLGDSAPALHLNKGTPSQSPVVGRSQAQQQEKKQFDLLSDLGSDIFA
APAPQSTATANFANFAHFNSHAAQNSANADFANFDAFGQSSASSNFGGFPTASHSPFQPQ
TTGGSAGSVNANFAHFDNFPKSSSADFGTFNTSQSHQTASAVSKVSTNKASLQSTDKYAA
LANLDNIFSAGQGGDQGSGFGATGKAPVGSVVSVPGQSSTSSDKYAALAELDSVFSSAAT
SSNAYTSTSNASSNVFGTVPVGASAQTQPASSSVPAPFGATPSTNPFVAAAGPSVASSTN
PFQTNARGATAATFGTASMSMPAGFGTPAPYSLPTSFSGSFQQPAFPAQATFPQQTAFSQ
QPNGASFAAFGQTKPVVTPFGQVAAAGVSSNPFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences E2RNM4
ENSCAFP00000015353 ENSCAFP00000015346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]