SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RNV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RNV5
Domain Number 1 Region: 9-149
Classification Level Classification E-value
Superfamily Cyclin-like 2.33e-43
Family Cyclin 0.000000227
Further Details:      
 
Domain Number 2 Region: 150-253
Classification Level Classification E-value
Superfamily Cyclin-like 5.53e-35
Family Cyclin 0.00000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RNV5
Sequence length 733
Comment (tr|E2RNV5|E2RNV5_CANLF) Cyclin T2 {ECO:0000313|Ensembl:ENSCAFP00000007497} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CCNT2 OC=Canis.
Sequence
MASGRGASSRWFFTREQLENTPSRRCGVEADKELSYRQQAANLIQDMGQRLNVSQLTINT
AIVYMHRFYMHHSFTKFNRNIISPTALFLAAKVEEQARKLEHVIKVAHACLHPLEPLLDT
KCDAYLQQTQELVLLETIMLQTLGFEITIEHPHTDVVKCTQLVRASKDLAQTSYFMATNS
LHLTTFCLQYKPTVIACVCIHLACKWSNWEIPVSTDGKHWWEYVDPTVTLELLDELTHEF
LQILEKTPSRLKRIRNWRANQAAKKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPS
FQKPSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSYSLSSHQEWPQHQESART
EQIYSQKQETSLSGSQYNINFQQGPSISLHSGLHHRPDKISDHSSIKQEYTHKAGSSKHH
GPISATPGVIPQKMSLDKYREKRKLETLDLDVRDHYIAAQVEQQHKHVQSQSASSSSVTS
PIKMKIPITNTEKPEKYMADKKEKSGSLKLRIPIPPTDKSASKEELKMKIKVSSSERHSS
SDEGSGKSKHSSPHISRDHKEKHKDHPSNRHHPSSHKHSHSHSGSSSGGSKHSADGIPPT
VLRSPVGLSSDGISSSSSSSRKKLHVNDASHNHHSKMSKSSKSSGSSSSSSSSVKQYISS
HNSVFNHPLPPPPPVTYQVGYGHLSTLVKLDKKPVETNGPDVNHEYSTNSQHMDYKDTFD
MLDSLLSAQGMNM
Download sequence
Identical sequences E2RNV5
9615.ENSCAFP00000007497 ENSCAFP00000007497 ENSCAFP00000007493 XP_533333.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]