SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RP85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RP85
Domain Number 1 Region: 290-417
Classification Level Classification E-value
Superfamily PH domain-like 6.3e-16
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Weak hits

Sequence:  E2RP85
Domain Number - Region: 22-78
Classification Level Classification E-value
Superfamily HR1 repeat 0.0128
Family HR1 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RP85
Sequence length 608
Comment (tr|E2RP85|E2RP85_CANLF) Rhotekin 2 {ECO:0000313|Ensembl:ENSCAFP00000019185} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RTKN2 OC=Canis.
Sequence
MQGPSGRRPELRPAGLPAQQDCSIQEKIDLEIRMREGIWKLLSLSTQKDQILHAVKNLMV
CNARIMAYTLELQKLEEQIANQIGRCDVNFESKERTACKGKIAISDIRIPLMWKDSDHFS
NKERSQHYAIFCLFKMGAEVFDTDMMIVDKTITDICFENVTIFNEAEPDFQVKVEVYSCC
IEDSSITNTPKKLAKKLKTSISKATGKKINLVLQEDHETCSSISLGVYGAKYNLLAHATL
TLESAEDSFKTHNLSINGNEESSFWLPLYGNMCCRLVAQPACMAEDAFAGFLNQQQMAES
LISWRRLYCVLRGGKLYCFYTPEEIEAKVEPALVVAINKETRIRAMDKDAKKKIHNFSVI
NPVAGQSVTHIFAVDNREDLQKWMEAFWQHFFDLSQWKHCCEELMKIEIMSPRKPPLFLT
KEATSVYHDMSIDSPIKLESLTDSIQKNLEETNGQLLVGQHEESSPPLWASLFDGNHQMV
IQKKVLSPTSKQLHDGKGKKRRAPLPPSDQAPFSLKTQSNTDQFVKDNWEKTSVSWTSPL
DSKLSTLMHHLQKPMAAPRKLLPARKNYLSDGERMDSKTSFEAKPVPAPRQKSVKGMLDP
RSWLQAQV
Download sequence
Identical sequences E2RP85
ENSCAFP00000019185 ENSCAFP00000019188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]