SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RPD3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RPD3
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.27e-33
Family Ras-binding domain, RBD 0.0025
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000225
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E2RPD3
Sequence length 663
Comment (tr|E2RPD3|E2RPD3_CANLF) Amyloid beta precursor protein binding family B member 1 interacting protein {ECO:0000313|Ensembl:ENSCAFP00000006427} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=APBB1IP OC=Canis.
Sequence
MGESNDDIDQMFSNLLGEMDLLTQSLGVDTLPPPESKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKESSQNQHHPASVEVPDFSGAAALSYGANVTAIS
VSQYENDLPPPPADPMLNLPLPPPPPEPLSQEEEAAQAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQLARDVLDNLFEKTHCDCNVDWCLYEIYPELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLNNKGRKEGKETNEKMNAKNKESLLE
ESFCGTSIIVPELEGALSLKEDGKKTWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDYCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRAMARAGLASRWTNQSTVSTAPPATSAAPSTGLKTSTPQANGQIPQAAHSVS
AVLEEAQRHVETTKDKKPALGNQGPGAPEVHQLPKSSLPPPPPVRRSSDVCSSPATAARA
RGLGGGFPAPAPPEDSLPPPPPPPPLDEDELPPPPPDFHDAPPDFVPPPPPSFAGDVGSA
LPPPPPPPPAPEAARPPRVALKRPPAPPKRKESPGPAVGGGSGEQDFMSDLMKALQKKRG
NMS
Download sequence
Identical sequences E2RPD3
ENSCAFP00000006427 ENSCAFP00000006427 XP_005617039.1.84170 XP_535169.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]