SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RSI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RSI6
Domain Number 1 Region: 199-344
Classification Level Classification E-value
Superfamily PH domain-like 1.7e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 89-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-38
Family Second domain of FERM 0.000000706
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 1.96e-32
Family Moesin tail domain 0.0000241
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.51e-26
Family First domain of FERM 0.000007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E2RSI6
Sequence length 586
Comment (tr|E2RSI6|E2RSI6_CANLF) Ezrin {ECO:0000313|Ensembl:ENSCAFP00000000937} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=EZR OC=Canis.
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVSEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKETHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDSAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AEKELSDQIQRALQLEEERKRAQEEAERLEADRVAALRAKEELERQAADQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQDNLQEEGTEYTGYSAELSSEGIMDDRNEEKRITEAEKNERVQRQLMTLTSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
Download sequence
Identical sequences E2RSI6
9615.ENSCAFP00000000937 ENSCAFP00000000937 NP_001273918.1.84170 ENSCAFP00000000937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]