SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2RTW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2RTW3
Domain Number 1 Region: 155-386
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.14e-57
Family RecA protein-like (ATPase-domain) 0.000000204
Further Details:      
 
Domain Number 2 Region: 81-141
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.000000000000832
Family DNA repair protein Rad51, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2RTW3
Sequence length 389
Comment (tr|E2RTW3|E2RTW3_GIAIC) DNA repair protein RAD51 {ECO:0000313|EMBL:EDO81751.1} KW=Complete proteome; Reference proteome OX=184922 OS=lamblia). GN=GL50803_13104 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MQSDSQGLYAGAAFSLMRRIRGLRMYVSSVYITNKLVRAMSRSVKKAQEQYVLSTSVSCT
QSDTETPVVAGDEAKETWAPIEELHALGIAAADTKRLRESGIFSIQGVLMQTHKDLGQIK
GLSEAKVDKILDAARKHSQPGFMSGVVALERRQRIRRISTGCSDLDALLGGGIESMAITE
VFGEFRSGKTQLCHTIAVTAQLDGSRVAYLDTEGTFRPEKIGPIAERYKLDPTTTLSRIA
YARAYTHEQQIELLAAAAEQMSEKKFALLIIDSLTALFRVDFTGRGELADRQQKLGQHLA
SLAKLADEFNIAIFVTNQVMAQVDGAAMFTADPKKPIGGHILAHASTTRLYLRKGRGNNR
VAKIYDSPSLPEAEATFAVGEQGVCDAEE
Download sequence
Identical sequences E2RTW3 Q6WDA6
XP_001709425.1.56740 GilaA.01580.a gi|157437541|gb|EDO81751.1| gi|159118412|ref|XP_001709425.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]