SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E2SID5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E2SID5
Domain Number 1 Region: 129-290,321-434
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.32e-28
Family Acylamino-acid-releasing enzyme, C-terminal donain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E2SID5
Sequence length 436
Comment (tr|E2SID5|E2SID5_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:EFP62660.1} KW=Complete proteome; Reference proteome OX=658659 OS=Erysipelotrichaceae bacterium 3_1_53. GN=HMPREF0983_00765 OC=Erysipelotrichaceae.
Sequence
MLAACSGKEEKKEDAKEAVEIQLTDEQSRMATQFAKDLTQRRYEKLLKDYSYDERMKETI
KQKDFQKQLNSYNDSLGKLLEAETPYGQSYQGSTIIMIPCRMEEQNTNIQLSLNEKNEIQ
GLFFKPYKTQKKSAKTPTGVKETTLNLKISNGKTLAGRLTTPSEGESFPLVILLAGSGPN
DMDETLYDNKPFQDIAWGLAEKGIASYRYDKRTYTYPESFTLQDTVEQEVIEDAVAAVKQ
GKLQSQINTKQIYILGHSLSGYLIPRIASQTKDCAGYIMMAAPARPLDELFLEQVTYLAS
LDGTITDKEQKVIDQYKQDQKDLANIDNLSDAKMFFGGMSKAYMKDLLSYDAVKQAADIE
APVLCAQGLRDYQVTEEDYSIWKKAFENKKNWSFTSYPKATHLMIDGEGKPTSEEYKTKG
HVNQKFIDDIASFILK
Download sequence
Identical sequences E2SID5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]