SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3EHM4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3EHM4
Domain Number 1 Region: 190-355
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 6.02e-45
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 118-201
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 3.53e-16
Family Homodimeric domain of signal transducing histidine kinase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3EHM4
Sequence length 374
Comment (tr|E3EHM4|E3EHM4_PAEPS) Membrane protein {ECO:0000313|EMBL:ADO56286.1} KW=Complete proteome; Reference proteome OX=886882 OS=Paenibacillus polymyxa (strain SC2) (Bacillus polymyxa). GN=PPSC2_10875 OC=Paenibacillus.
Sequence
MKREPGFLRILARFMLVLLVLYLSWTAAYFITAVIYSRLSWTPHELFVYLINATLGFFFF
GIISMTVRRFIQPREQHFFTEMIDALKRISEGDFHINLGWNFGTRNGNHDRTHPYIQLVD
SINDMAANLKVMEELREAFISNVSHEIGSPLTSIIGFAKALKDDNLDREQRDRYLTIIET
ECIRLSKLSDNLMKLAVLDSERHPFHPSSYRLNKQLISLILACEPQWEAKQIDMIVDTHN
VQVNADEDLMGQVWVNLLHNAIKFTPQGGSISVSLSSNGNQAVVCITDTGPGINEQDQQR
IFERFYKADKSRTRTAGGSGLGLSIAHKITEMHSGSISVSSKVGEGTAFTVLLPLQEETV
KGNSNHEMSGNSGD
Download sequence
Identical sequences E3EHM4
gi|310641769|ref|YP_003946527.1| WP_013370892.1.14980 WP_013370892.1.41886 WP_013370892.1.91857 gi|386040773|ref|YP_005959727.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]