SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3FRW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3FRW4
Domain Number 1 Region: 22-290
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.28e-78
Family Eukaryotic proteases 0.001
Further Details:      
 
Weak hits

Sequence:  E3FRW4
Domain Number - Region: 313-388
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0124
Family Collagen-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3FRW4
Sequence length 392
Comment (tr|E3FRW4|E3FRW4_STIAD) Peptidase, S1A (Chymotrypsin) subfamily {ECO:0000313|EMBL:ADO68299.1} KW=Complete proteome; Reference proteome OX=378806 OS=Stigmatella aurantiaca (strain DW4/3-1). GN=STAUR_0495 OC=Cystobacterineae; Archangiaceae; Stigmatella.
Sequence
MSNPVTVSAASNPLTRRKSWALIASMGAALAAGCGPEAAPETQATLGEASQEIVGGTNAA
ITDFPWQISFQSSSGSHFCGGSIIDANWILTAQHCVYEAANSPSHPSTVRVGAGSATRTG
QVQIKQITDIIPYPGYSDATLGKDVALLRLSSPLTFNTSVKAIPLATAADVSAGRTDPGV
VSTVTGWGTTSSGSSSLPTTLQKVDVPVVSNATASANYGMTITADQIAAGYAAGGKDSCQ
GDSGGPLVVNGASGKILAGVVSWGEGCALPNYPGLYARVSSFQPWINGIITKTPSSLLSQ
TGASAGSKAWKHYTITVPAGVSALTVAASGGSGDADLYVHTSTPTTSAYTCRPYASGNTE
YCSIGSPRAGTWYVSLYGYTAASGVTLKATAY
Download sequence
Identical sequences E3FRW4
gi|310817768|ref|YP_003950126.1| WP_013374182.1.13107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]