SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3FVS3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3FVS3
Domain Number 1 Region: 497-601
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00000183
Family Collagen-binding domain 0.0081
Further Details:      
 
Weak hits

Sequence:  E3FVS3
Domain Number - Region: 35-135
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00144
Family Collagen-binding domain 0.0082
Further Details:      
 
Domain Number - Region: 157-200
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.00641
Family Collagen-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3FVS3
Sequence length 621
Comment (tr|E3FVS3|E3FVS3_STIAD) Conserved uncharacterized protein {ECO:0000313|EMBL:ADO73463.1} KW=Complete proteome; Reference proteome OX=378806 OS=Stigmatella aurantiaca (strain DW4/3-1). GN=STAUR_5700 OC=Cystobacterineae; Archangiaceae; Stigmatella.
Sequence
MRRLVWIAVCAALAGCPKGKEEVPDAGPPIDPGPDALTEKEPNERPDQALALIRDAVVTG
ALSADPSKQDEDWYRLAPSTARTADITLSGIPGVDVTLEVYDRDRNRLGNVNSEGEGKPE
RFPNLFVEGERFVRVASARKGSGGAYTLTLSYRRPNDGEEREPNDRAVDASPLTLGQAVA
AYIGHSGDEDWYRVELPAPEAASPPSAEPPPPPPTEAPPPTPPTEGLAAPTEEATTPTEG
IVPPEALGGDAGVPGAVAQGGDAGAPPPPEPPSVALKIDLSALDGVRPEISVLSAAEAPL
FSLRGKEGEALSLRNIGVRATDRMVYVVVKSGWMGTGKEARRAYNATNAYTLSVSLEEAG
ANAELEPNDELYKATPLTSAGFKEGFLAPKSDVDHYVLRTSEPVLAKVELSGVDRLDLVL
SAVEPPTGDGAQETVTLRANDGAVKEPERLNNVSCRETCYFRVESATRKIDGKWVKDFEN
ADLPYRISVTTVPDNGSEESEPNNTAARATELTFGKPLRGTVYPVKDVDYYRLDLSDRPV
RTSLRATLLGILKVDVGLYLHRMGEDGKLSLVQTADRAKGDQPETIRYSAEPGVYLLEVR
DTKNRESNFQDAYQLSVEEGE
Download sequence
Identical sequences E3FVS3
gi|310822932|ref|YP_003955290.1| WP_013376923.1.13107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]