SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3GW98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3GW98
Domain Number 1 Region: 39-167
Classification Level Classification E-value
Superfamily Sortase 6.41e-25
Family Sortase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3GW98
Sequence length 241
Comment (tr|E3GW98|E3GW98_METFV) Sortase family protein {ECO:0000313|EMBL:ADP77863.1} KW=Complete proteome; Reference proteome OX=523846 OS=V24 S). GN=Mfer_1069 OC=Methanothermaceae; Methanothermus.
Sequence
MCTGGGNVKVKLSTVMIIVGVFIIFLYALIEVSYYASKITIENKYTATLEIPAINLKEEI
NNKSLSYGVYYDPRSSIPGSGTTVLFGHRTLYGSPFMNLDKLKKGDVVYVNWPKVGKIEY
KVDKSFVVPADYEIPLRQGNKLLLVTCYPFGSTSKRLIVECKIVKILPLEKIKVENPNKN
YSLAIIVLFFLFCMLIYKIYPYREDKLILLVVFLSLTLILIFAYINPVPPEFISDKLLSW
S
Download sequence
Identical sequences E3GW98
WP_013414141.1.12012 gi|312137288|ref|YP_004004625.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]