SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3GZ52 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3GZ52
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.85e-127
Family Methyl-coenzyme M reductase gamma chain 0.0000000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3GZ52
Sequence length 249
Comment (tr|E3GZ52|E3GZ52_METFV) Methyl-coenzyme M reductase subunit gamma {ECO:0000256|PIRNR:PIRNR000264} KW=Complete proteome; Reference proteome OX=523846 OS=V24 S). GN=Mfer_0785 OC=Methanothermaceae; Methanothermus.
Sequence
MAQFYPGSTKIAENRRKFMNPDAELEKLREISDEDVVRILGHRAPGEEYPSVHPPLEELD
EPEDPIKDIVEPTEGAKAGDRVRYVQFTDSVYFAPAQPYIRSRAYLWRYRGADAGTLSGR
QIIEARERDVEKIAKELIETEFFDPARTGIRGKSVHGHSLRLDENGMMFDMLRRQVYDEE
TGRVKMVKNQIGDEFDEPIDLGEPLDEETLKEKTTIYRIDNIPYREDKDLLEIVQRIHQL
RSEAGFSPE
Download sequence
Identical sequences E3GZ52 P12973
gi|312137009|ref|YP_004004346.1| WP_013413862.1.12012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]