SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3K1M5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3K1M5
Domain Number 1 Region: 369-511
Classification Level Classification E-value
Superfamily PH domain-like 9.7e-21
Family Ran-binding domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3K1M5
Sequence length 539
Comment (tr|E3K1M5|E3K1M5_PUCGT) Uncharacterized protein {ECO:0000313|EMBL:EFP78200.1} KW=Complete proteome; Reference proteome OX=418459 OS=(Black stem rust fungus). GN=PGTG_04156 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MTDQKSSSTTTTEAHEVKSVREQVEGMGVETEQANIVASDPKTHSTPRTQQNDLDNSPTS
STKGKDLPASWDAYADLQSPFACFAPRTTTWSYAQPSDQSAKEDSTNPPARALAPPPKQV
STAPAFSLTGQQTATNSLCPNKFPSGSDFFLKGKRNTSVADSSPELDEDSASQSKKPKLP
PPVNSSASCPPSSSSSKRNHPLSPTSLRSAALEKFNSNPSLHTTSVQSSTVSTFLDVHPP
SSKASSACADNGENEDSASSTIPSAIPPSEAQKASNNKPLGFSAFATSTGFGDSSAKPTI
DWSDGRVSSPSVFDQQPPSSSKPSHPSQPESQQNPVSEWGGGQTGERKTHLALSAELGQE
DKHEGFLATEVITGEENAELDKSVRCMKFTLGEDQSWRERGTGGLRLLRTKEEPYRYRLI
MRADAVLRVLLNVPIFHGFSYRPTQDKFLTFASTVALEPSAGSGSGTTAPAENEGEPGKT
QFQQYLCRFGKPEARQEIIDSIERCLKDLNQQQKQQSIPDNNQGNHEDPSSVVDASDLV
Download sequence
Identical sequences E3K1M5
PGTT_04156 XP_003322619.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]