SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3K9X8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3K9X8
Domain Number 1 Region: 528-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-85
Family Protein kinases, catalytic subunit 0.0000000225
Further Details:      
 
Domain Number 2 Region: 21-204
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3K9X8
Sequence length 809
Comment (tr|E3K9X8|E3K9X8_PUCGT) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS00977200} KW=Complete proteome; Reference proteome OX=418459 OS=(Black stem rust fungus). GN=PGTG_07225 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MSFSIPFGSLIPSRPPPAPPNQQQQQQQNQQQHQQKENHLSSSSSSTSSTSPYQHHHQSF
NQRSSLHQSITSGHAPSILSKSTSSMIGSAPFPSNPSSPSLSGSNLALQPNPTTIVRRGF
AKLKEDGLRSWIWSQRWLILREQTLTFHKNETTSTAAALIFLKEITNVTRTDLRPYCLEV
ETKDKTYNLALKNDEELYGWMDDIYSRSPLMGVSNPTNFVHQVHVGFDAVSGAFTGLPEQ
WTRLLTSSAITKEDYAKNPQAVLDVLEFYTDIQKRENEEYPIGSGGHQHQQSIDTSKLDH
YHHQHQHSESTHPSPNIQNNNSQNSSNTGFSSYPSRTAPSPVIQHSESSNHSAGLGDPGQ
SSSSTNFPRINNPQPSQSRPNLVPQRVAPVAPSATPGSGGLKPLSLSSSASPRPPVQPPR
ESAKQLAPAKTQGPKPLTLGQPRPANGATTTTTTTNNNNNNTGTAKPSGNAVPAKPAASA
PPSQETNQPAQAPIKALQTVKKQEAKQNERRISSLTEAQIMAKLRTVVSPQDPNQIYAKI
KKVGQGASGSVYVAKTLATGAKVAIKQMDLKVQPRKELIVNEILVMKESQHPNIVNFLDS
FIVRDDELWVVMEFMEGGALTDVIDNNTMEEDQIASICFESCKGLQHLHNQSIIHRDIKS
DNVLLDAQGHVKITDFGFCAKLTDQKSKRATMVGTPYWMAPEVVKQKEYGAKVDIWSLGI
MAIEMIENEPPYLDEEPLKALYLIATNGTPTLKKPERLSKELKNFLAVCLCVDVKSRATA
DELIQHEFLKKSCTLAGLAPLLKFKTSSR
Download sequence
Identical sequences E3K9X8
XP_003325392.1.73186 PGTT_07225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]