SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3KE64 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E3KE64
Domain Number - Region: 25-159
Classification Level Classification E-value
Superfamily PH domain-like 0.00012
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number - Region: 173-211
Classification Level Classification E-value
Superfamily PH domain-like 0.0762
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3KE64
Sequence length 1201
Comment (tr|E3KE64|E3KE64_PUCGT) Uncharacterized protein {ECO:0000313|EMBL:EFP82606.1} KW=Complete proteome; Reference proteome OX=418459 OS=(Black stem rust fungus). GN=PGTG_08802 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MSQPTGTGLTPTHDLERLIDLFRLPKFYYEGFIFRRTILLSDGAPPKRTDQNALWAKYYV
QIAGTTMSCWDAAEIEMAAQEGRQVAPTYTNITDARVDLPDPHSSAHSTELLNPPSPHLF
FLNNAGRNKFGFACLDQHSLLAWVSAIRLSSWERSRLFEIYTGTLLGLRFFNHLDSPTPN
EKAEGYLTIRFPKDTEWTKVWAVLVRDKALLNGTAPQNYYLKDNKWNRRGSLFNLAGLVN
KTQHSPSSSTTLIDPDATRTEPGLVFYPKKGAKKHIGILTNISFAAAVYPESRALIESST
MFKLEGRFEGIMASHDGRPSESQTASVDQEGFILATPDEGTECDMLGWLLGVMSAFRLYG
KPAKFNYDPTDPNSFYFAYPIGPERERLFLDCQTVAESLDVQEHSLAQLRQKFTSLVAAR
LHLPRKSVADLPESVHEPYEPIVTTPQSIDEPLSYLSAQSPSSQPALKSLDHSSTPRSPP
SVTLQPSPASESPASDPNSSYSDPPLTSEIPENALRPPTSEPPSSDHHSRSPVTPQSQSE
LLEVGKPARPLSTLDDDLVSFAAYVTYEDPVDTPEVPTSLLISSPSPASSPSKSPSATLA
PITEKTHQSSSDNPPDPVSPSRQAASQSAANDPIPEGYEDMIYALSLVDQESPMVPPPQE
DSIGPSKSAQAPSTRSDSPQLEFLSRPPPASVSPQPNSAPISPDAQAVKPSFPSSFAAGK
KGAARLAAAQAAQAAGKASGFRPGKPGRTASAGQKKPPSSWNSSDSEDDDDDENPNDDDD
EEDEDEEGEEDDRLKKHRLTTAMPSSISQVNSERGFQANQERKTMLLPQATTREGTYSMY
STGGPTSDSRPISQAVSSAGGSGGGAGGEMGQFPNPANRREVPAVLRDQPAETGAENNGL
RPAFSQHGLLHRVMQERQEKSAKSIQEAAHWSGEPLVQVNHKPPPIQSGLLGAIASHERD
RKRDGGMGAMLTERARERALRQRETDELQRQSMFMMAGAGPMGFPNQPGFNQLPMLQMMY
NHQPHLFPTAAGMPTPYEQMMFQQHQFQLQQQAILNAQQYMVGAPYPYSAAPLLQQQQQQ
QQSLANGANPSGTLSTHQSVYGFPLNIQQQQQQQQAQFGFLPLPSQQQQQPLTLNPHLNP
QHQASLNNHHPGPVVGRPASAAAPAPLLPGSSSATTLASAAAAAGNPSSNGPNHLYSYHQ
S
Download sequence
Identical sequences E3KE64
XP_003327025.1.73186 PGTT_08802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]