SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3KUD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3KUD5
Domain Number 1 Region: 30-203
Classification Level Classification E-value
Superfamily PH domain-like 1.99e-33
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 2 Region: 428-555
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-20
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3KUD5
Sequence length 576
Comment (tr|E3KUD5|E3KUD5_PUCGT) Uncharacterized protein {ECO:0000313|EMBL:EFP87910.1} KW=Complete proteome; Reference proteome OX=418459 OS=(Black stem rust fungus). GN=PGTG_14625 OC=Pucciniomycetes; Pucciniales; Pucciniaceae; Puccinia.
Sequence
MTHTNSRPTTSTKKPLSNLIIPTTTLTTTTTTPTNQHQQQQQHQQQIDIQAINQTLSSPI
NSSFPLFATNPQPNSALQLDIESEDDEEEDPYQPSTSHYRQFGDIENEEILHSGYLLKKG
ERRKTWKRRWFVLRKTCLVYYKNEKEYCLLRIIPLTEIHTCAEVEVKQYDNTFGIVTPAR
TYYVRARSRTERNQWTSKVTAASLLLKSLENPQRPQPSAQKPSSNPATPSAITIINQPCY
PTGLPPTPICSPNQTTTNPISIVQHGEPSSSSSAVSWASDHFNLCQPSKVEALDNTATIT
KASIRRGLSLSAQPFETAPYESPASYHHPPMPFRANLSSAGSSAGNHQQSSETSFATSQP
SQVPQHSIPALMSSSEEDNEVDDTLPPTRRATCGPNTHDHLIHNPTDNLTIPVPILPERK
VSLPEAGKTIIQGYLMKQGKRKNWRKRYFMLTSQKLIYSRTHMDVGGRHTRQIPIGRLLD
AIEHESAPESPGILSGSVVGGTTSTHSGGGGGPSGPSTHHEDHYFKIITSQRNYLLNAPT
EDDEIRWISAIRCLLDSHRANLPRSFDGILDHPINP
Download sequence
Identical sequences E3KUD5
PGTT_14625 XP_003332329.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]