SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3M8L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3M8L5
Domain Number 1 Region: 250-356
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E3M8L5
Sequence length 524
Comment (tr|E3M8L5|E3M8L5_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFO95787.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_13901 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MLHNYDVANDFGAKMQTGAPQAPRNTLLSVDQQLQLMNTINNMVRASQFTSQLANTIFTL
CAQLKTSGSMLEQSHKNELNKVFTSLRQACCRDNGQLGTPCRLKIMELVELRAMNWRTNL
AHSQYYVNRPEGQHDPAPTVGIPPPSATSSQMTSSVTSPVPQSPQPPMHSFVPQNPMMFQ
DPMGGARDFQANPGGIFFIPAASTWMNPLMPMPPNPFLPHSMMPPDHQMFLRQRSLNNKK
PNNLMNKTLQLRHEMIIRNSDSGKIMGVKGRRVAAVEQLTNTVISFQKVDAKSKERTLTI
TASTMEDIERAKDMIIDTIRRNMSPIRTDMSIPPPMPMSSDLHPSQQHSQQPTQGGSPED
EEDDDDEEDIKLEQTSDGKLTFHCDDPELLAAAQEALSAYLRVRARPSAEEREKKKERRK
SMPLQQTAHHQQDVPVMLKPSKTFHGSTPNLADGLAATTTVVMATTVAPQQMVAAQHVHQ
PQIIGDPIRYNRDILMTARETQRQAMTPEMLKEITAVAPDILIA
Download sequence
Identical sequences E3M8L5
CRE13901 31234.CRE13901 XP_003107467.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]