SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3MK31 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3MK31
Domain Number 1 Region: 243-335
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 433-507
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000541
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 338-406
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000365
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  E3MK31
Domain Number - Region: 85-133
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000552
Family Eukaryotic type KH-domain (KH-domain type I) 0.008
Further Details:      
 
Domain Number - Region: 188-261
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0232
Family Eukaryotic type KH-domain (KH-domain type I) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E3MK31
Sequence length 586
Comment (tr|E3MK31|E3MK31_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFP03902.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_28700 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSERKRTLDVDQEGSASKRPLNSDPIDYSNDYSPRSPSPIRSPSIASYSPCPSPSPPVSP
TPIIRKIERRTFEVPEKFLDSVSKRIHEVQKETGCNVCVSTRITGWTRTVYLEGFQEDIE
LAIDRIDELVTSSVGFIHQVATRYLKFGDGMSPRSPSPPRKSLRSEYSPYKSPRDESDED
IEIIDNPRVSRELLIPLGLYGSFGSPMREQTVSICKRNGVNWNVPDAETSSKTEEKLVMR
LYGVEESVEKAMKEIEEFMENYSEDEMLIHTTKVSRVIGKNGGTIQLISEKSGAVCHFDR
ESLDDSLESSKTLRITGTATQIEKAKEMVQDLIDSTRCFMEIPYRLYDDVVGDKKENITY
ISAVSGAECVAWSGDDERKTTIRIQGTEKQVEHAKSLLQDAIDKEHKKGGPLVVSELYIL
AIWAEMDRPVQFNTMNVPTEKVDQVIGVSGSYINLIREQSNACIEYDPRGPVKKFLISGT
TVQVETAKALIKEVTDGPPQVSIPVWNRFEPRMTSGPALTLTPPPSPHSPLFYQNMPPQF
SFQASPYYPGPSGPSNAPRIPYQYLPQPPSSLFAQYIPRPPFFPPR
Download sequence
Identical sequences E3MK31
31234.CRE28700 CRE28700 XP_003103528.1.11157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]