SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3NLS7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3NLS7
Domain Number 1 Region: 64-140
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000441
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3NLS7
Sequence length 173
Comment (tr|E3NLS7|E3NLS7_CAERE) Uncharacterized protein {ECO:0000313|EMBL:EFP06044.1} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_09883 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSPTNADLNKVKKEITRVKKNRPDSQRRRQMRRRQGKEGTKKQTPPHAQAQNSNKDPANK
KAHEGDGEILAIKVLIPSSAVAAIIGECGVVMNTLRKDHKCQIQISKNETYPGTLEQICI
MKGSLRNILAVIESIQEKIRMKCADQVGNDAFDHANTLRIVETNFLDIRCLRT
Download sequence
Identical sequences E3NLS7
XP_003090644.1.11157 CRE09883 31234.CRE09883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]