SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3NTK8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3NTK8
Domain Number 1 Region: 142-245
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000217
Family Eukaryotic type KH-domain (KH-domain type I) 0.0079
Further Details:      
 
Weak hits

Sequence:  E3NTK8
Domain Number - Region: 100-156
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0327
Family Gametocyte protein Pfg27 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3NTK8
Sequence length 368
Comment (tr|E3NTK8|E3NTK8_CAERE) KRR-R motif-containing protein 1 {ECO:0000256|PIRNR:PIRNR006515} KW=Complete proteome; Reference proteome OX=31234 OS=Caenorhabditis remanei (Caenorhabditis vulgaris). GN=CRE_17767 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MSKAAKPPRGEYEPDWADEPEEEKKTRKETAKMFGPQKDPEWWDINTFSKEDNPNGLLQE
SSFSSLFPKYREKYIKESWPLIEKALGEHFLKADLDLLEGTMCVRTTRKTWDPYIIMKAR
EVIKLLSRSVPYEQAIRVLEDEIYCEIIKISSMVRNKERFVKRRARLIGNDGATLKALEL
LTQCYVCVQGGTVCAVGPLSGLKQINQIVSDCMKNIHPIYNIKTMMIKRELSKNDELKDV
NWDQYLPNYRKKVQSASTTKEAKKKKAYKMKPKGEYTPFPPAPVMSKIDKQIESGEYFIR
ENERKLNKKRAKLEASAVKTVEKQKQKLKVYQAKEEAPREKQTKKRPTDTPIDLEKLKKK
AKLSKAAK
Download sequence
Identical sequences E3NTK8
XP_003088263.1.11157 CRE17767 31234.CRE17767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]