SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E3QUF5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E3QUF5
Domain Number 1 Region: 20-269
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.35e-65
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000014
Further Details:      
 
Domain Number 2 Region: 358-523
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.66e-45
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00000667
Further Details:      
 
Domain Number 3 Region: 271-352
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000255
Family Rhamnogalacturonase B, RhgB, middle domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E3QUF5
Sequence length 532
Comment (tr|E3QUF5|E3QUF5_COLGM) Rhamnogalacturonase B {ECO:0000313|EMBL:EFQ34493.1} KW=Complete proteome; Reference proteome OX=645133 OS=anthracnose fungus) (Glomerella graminicola). GN=GLRG_09637 OC=Colletotrichum.
Sequence
MHRFGLAVGLSLLWKTAYAAFGIVETNSSYTVDTDGGLVFEVDRSNGDIISLLYNGVQYQ
EPTKMSQINSGLGTSTVAAETLNGIIKITVKAGSQPLTHYYVAKPDDPTVYMATHITGEI
DPGELRWLARLQRSRVPTGVHGDVADLDGCVAFEGKDTFKCPDGTTRCKMYTSDRFIEDK
VHGVTGNGVGVWMIMPGNAYEHSAGGPFMRDVNSQSTVEQELYWYMNSGHVRTEPWRFGL
LGPYAMRFTNGQQPSSDLDTTFFDSLDIEGYVPNNGRGSVSGTASGIPSNFETVVHWFNK
DAQYWTKASAGKFESPLMKPGTYTMKIYRDEFPVGNDTVTVTAGCKVTQDIQSTEPSPPV
LWRIGEFDGQPFELKNGDKITRMHPSDVRMASWGGAFTVGKSQANDFPMALFSKIGGNAS
VTFDLAANQLEGVTLRVGTTLSFKGGRPKVQINNWQASDPGAPTRIDSRGVTRGAYRGFG
EVYEWGVPASELKNGTNTLTLGVFGSGDQDFLSANYIIDAVELQAAGPSGSR
Download sequence
Identical sequences E3QUF5
EFQ34493 XP_008098513.1.39555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]