SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4SFM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4SFM0
Domain Number 1 Region: 308-472
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.97e-29
Family HD domain 0.028
Further Details:      
 
Domain Number 2 Region: 208-304
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.48e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4SFM0
Sequence length 521
Comment (tr|E4SFM0|E4SFM0_CALK2) Ribonuclease Y {ECO:0000256|HAMAP-Rule:MF_00335, ECO:0000256|SAAS:SAAS00548727} KW=Complete proteome OX=632348 OS=2002). GN=Calkro_1693 OC=Caldicellulosiruptor.
Sequence
MQKISETLKFVIIGAIVLVASMVAFFLGYLYRKKIAEKTIKSAEQEAQRIVEEAKKQAEA
YKKEATLLAKEEIHRARSEFDREVRERRAELQRFERRLIQKEEMLDKKMASVEEKEEQLN
QKLKDIQKLQEEIELLKQKEQEELQRISGLTQEEAKQIILKSVEQDVKHDVALMIKELEQ
QAKEEADKKAREIIATAIQRYSSDYVAENTVSVVTLPNDEMKGRIIGREGRNIKTFETVT
GIDLIIDDTPEAVILSGFDPIRREIAKLTLEKLILDGRIHPARIEEMYEKAKREVENKIR
EEGERVVFELGIHNLHPELIKLIGKLKYRTSYGQNVLAHSIEVANIAGIMAAELGLDQSI
AKRAGLLHDIGKAVDHEMEGSHALIGYELAKKYKETNPDVLEAIGGHHGEMETRSIYNVL
IQAADSVSAARPGARRESLESYIKRLQKLEEIANSFDGVEKAYAIQAGREIRIMVKPDHV
SDDDIVIMAREIVKRIESELDYPGQIKVNVIREVRAVEYAK
Download sequence
Identical sequences A0A2G6VFR9 B9MQY5 E4SFM0
gi|222528980|ref|YP_002572862.1| 521460.Athe_0988 gi|312622751|ref|YP_004024364.1| WP_013430636.1.1144 WP_013430636.1.20482 WP_013430636.1.22435 WP_013430636.1.28668 WP_013430636.1.33084 WP_013430636.1.45436 WP_013430636.1.58293 WP_013430636.1.61668 WP_013430636.1.71443 WP_013430636.1.77617 WP_013430636.1.9959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]