SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4TF16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4TF16
Domain Number 1 Region: 11-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.8e-47
Family NQO2-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4TF16
Sequence length 164
Comment (tr|E4TF16|E4TF16_CALNY) NAD(P)-dependent nickel-iron dehydrogenase diaphorase component subunit HoxE {ECO:0000313|EMBL:ADR19456.1} KW=Complete proteome; Reference proteome OX=768670 OS=Yu37-1). GN=Calni_1548 OC=Bacteria; Deferribacteres; Deferribacterales; Deferribacteraceae.
Sequence
MFGRPTLPSEDKRWKIIQNTMKKNGYNPDSLIEVLHAVQEYFGYIDEDALKFVSESLNIP
YSRAYSVATFYHYFTLKPQGEHICVVCTGTACYIKGANQLLAHLKNHHDLSDGDTTKDGK
VSLLTARCVGACSLAPVVVVDNKILGEINSEKLDDVIKGCRDAV
Download sequence
Identical sequences E4TF16
gi|313673508|ref|YP_004051619.1| WP_013451667.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]