SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4TJ54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4TJ54
Domain Number 1 Region: 2-75
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000238
Family Thioltransferase 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4TJ54
Sequence length 81
Comment (tr|E4TJ54|E4TJ54_CALNY) Redox-active disulfide protein 2 {ECO:0000313|EMBL:ADR18090.1} KW=Complete proteome; Reference proteome OX=768670 OS=Yu37-1). GN=Calni_0177 OC=Bacteria; Deferribacteres; Deferribacterales; Deferribacteraceae.
Sequence
MNIKILGTGCRNCEILYKTVCEAVEQLQLTDVTIEYVKEINEIIKYVMTTPGLVIDEVLV
HEGKPLPNVEQVKNIILQMKK
Download sequence
Identical sequences E4TJ54
gi|313672142|ref|YP_004050253.1| WP_013450307.1.25879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]