SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4U5B0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4U5B0
Domain Number 1 Region: 114-538
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 2.49e-105
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.00000000251
Further Details:      
 
Domain Number 2 Region: 1-127
Classification Level Classification E-value
Superfamily Cytochrome c 8.92e-25
Family N-terminal (heme c) domain of cytochrome cd1-nitrite reductase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E4U5B0
Sequence length 539
Comment (tr|E4U5B0|E4U5B0_OCEP5) Dissimilatory nitrite reductase (NO-forming), cytochrome cd1 type apoprotein {ECO:0000313|EMBL:ADR37584.1} KW=Complete proteome; Reference proteome OX=670487 OS=506). GN=Ocepr_2134 OC=Oceanithermus.
Sequence
MRWSKALTVGLAALALGALAVAQGLTPEQMEEGKKIYFQQCAGCHGVLRKGATGKNLEPD
KLKAAGKNVDYLKAIITNGFGGMPAWGKLGILTPEQIDLMAKFLLSPVPEPPPWTFEDIK
NNWVVYVPVSKRPTQPETTRNWQNFFGVILRDMGQVAIVDGDTKELVKILPTGYATHILR
SSKDGRYFYVIGRDGKAEIIDLWSKEPTLVAEAKVCLDARSIDTSKYEGYEGKYAVVGCY
WPSNFVILDGQTLEPLKMVSTQGYVKSTGEFLRENRVASIVSSHFSPEWILNIKEGGQTW
LVDYANIGLKGKPINVRMIDTERFLHDGGWAMDKRYFLVAANAAKKIVVIDAKTGEFVAS
IPVGDKPHPGRGANWVHPKYGPVWATGHIKDNKIAVIGTDPKGHPDYAWKVVKMIETPYP
GNLFIKTHPKSPWLIVDFTVAPTPEANATLCAWKKEDLEKDPICWEVPGAKKLKARMVHI
EFNKDGSEFWVSAWGNKDTPTFIVVYDSVTLQEKTRITGDWVRTPTGKFNVWNTANDIY
Download sequence
Identical sequences E4U5B0
WP_013458754.1.73382 gi|313681018|ref|YP_004058757.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]