SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4WQC7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4WQC7
Domain Number 1 Region: 191-258
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.81e-21
Family DNA-binding domain from rap30 0.0004
Further Details:      
 
Domain Number 2 Region: 23-135
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.0000000000000173
Family Rap30/74 interaction domains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4WQC7
Sequence length 259
Comment (tr|E4WQC7|E4WQC7_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY20868.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00000876001 OC=Oikopleura.
Sequence
MSEAGSSQEPVQKKRKRERDPNQLKMNTANSGLNWWLVKVPKYLGEKWLSSPTSEVGKIE
IRRDKGRTEVNFKLDERLANQGETRTPIDHKLRLSAPSKSETIGILCRSKKFEDGQEIEE
RSVEGTIVQNAVCSPASMSCDLYMKQKLLNFKGPEMQRKRAVQLTEVPQHIKPVNGITRK
EIQEAKGNEKRTRMDDNQLTSRLLELFEKHQYYTLKDLCDITKQPTAFLKEKLKEIAVYN
SRATQRNMWELKPEYRNYD
Download sequence
Identical sequences E4WQC7
GSOIDT00000876001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]