SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4WXV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4WXV5
Domain Number 1 Region: 641-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-52
Family Protein kinases, catalytic subunit 0.00000135
Further Details:      
 
Domain Number 2 Region: 36-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.49e-48
Family Ephrin receptor ligand binding domain 0.0000262
Further Details:      
 
Domain Number 3 Region: 302-499
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-29
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 891-954
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000103
Family SAM (sterile alpha motif) domain 0.0061
Further Details:      
 
Weak hits

Sequence:  E4WXV5
Domain Number - Region: 231-298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0286
Family Growth factor receptor domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4WXV5
Sequence length 981
Comment (tr|E4WXV5|E4WXV5_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY22199.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00011750001 OC=Oikopleura.
Sequence
MEFHSELNSARIECLLTQKRILSQADLNSTRIAHVLRITWDEISGHDDAGNEYRMFQICE
ITRTDQQNWLRTNYINTFSANRVFVEIEFTIRSCEDLANVKVCRETFNLLYYEADNEQDT
PQWNTLHYKKVDTVAADRRFSPEADSRHRTNFETREIGNLTKNGLFIAIQDTGACMALMH
LKVYYKFCPETVENLAVFPRTVSGPDLTSLEEATGTCVNNAQMDPSQSPRLYCNAKGDWT
LPTGKCQCVAGFSPSKGLFFVRTLPSCPRNAVSNYGGADVCTCRAGYYRAADDSVDAACS
TTPSAPRDFAAFDISDNDMRLSWMGPSDFGDRREIEYKIECTQNNLPCPRSVDASPNWIV
QSRSVQIHGLDSSSNYEFRVYALNDISSIAGGEAAYAQVIVSTADRSPAGIAMVEIVQYT
SSTARIAWQEPRITDGVVNGYETVLENKNNGGIIRNMTTDQEIFFSGLVPSNVYVFKVRA
RTSNGLSPYSNPEEFKTYSANTRIPSRNPEFQESTVVNEESNTGAIAGAAAGGAVILIML
VVFLVICTRKNTYHKGDKYVHELGVTDVTFHPVHPVGKNAAIYGMEHTPWLANTSDNQHQ
ANQELEVSQVEVGSTLRRATGAQMVEIFHGSFRPFNGQAPEPALIKRLRVGFTGQQKAEF
LNDADIIAQFRHENVLEIKGVISHTMPLMSVYEYMEHPFADEFLRMHRGQLSQVQLQGMI
RNVAAGMKFLIEQGYLHRDLQCAHLAVSANLNVKIAEFSQARRLAESFVPTVGKCSYKWS
APEVISQRIYSEASDVWSFGVTAWEIINFGDAPYWEMNDEEVIRKIETGYRLPLGANCPP
ALQQILLECWKSASNERPPFNRILKQLDLSLRSPSNRTSQYSGSCMTLDSNASSASSLGQ
WLEGIGLAQYRERLQQNGFGTLDEIIQMSRTEMRDLGINSLNEQNHLQDAARAFAHSRAR
QTIPYGNRCDMSLERGTTVAV
Download sequence
Identical sequences E4WXV5
GSOIDT00011750001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]