SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4XGM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4XGM3
Domain Number 1 Region: 362-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000033
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 226-348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000738
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 175-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000661
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 107-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000179
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  E4XGM3
Domain Number - Region: 964-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 873-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0282
Family EGF-type module 0.065
Further Details:      
 
Domain Number - Region: 1093-1140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0464
Family Laminin-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E4XGM3
Sequence length 1431
Comment (tr|E4XGM3|E4XGM3_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY09821.1} KW=Complete proteome; Reference proteome OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00010636001 OC=Oikopleura.
Sequence
MKMRPVQLALAAAALAQQATELRPSDANVCSSTQIVKKQKRQPVVKQADRTKKVWKKNCP
NGQRWCIDYETTKVFYTTFEQVTVDEEVTVYSCCAGWAQGSEAGCTVQVCGAGACFHGGF
CSKDGTTCICKNGWTGTRCERDINECEVGNGQCSHQCCNLVGSYKCSCPQGWLLLSDERT
CADIDECQERNGGCAHQCHNVDGGYQCTCDAGYKLHNDQRSCLPTNRCARDNGNCAQKCI
VLNEHSFKCDCEEGYVLSENGRNCELEDPCLRDNGHCQHNCQSVGQQAVCSCDAGFKLDK
DGQKCIDADECVHNNGGCSGICTNTEGSFFCSCQDGYDVGEDGFTCYKVVIELISRKKPG
RDGCQHSCSEDSGEAICKCRNGFQLEIDGKSCRDVDECATGRHKCQHQCRNIIGSYECSC
RVGFAIARDGVSCEDVNECYDQNGGCDQICNNAQGTYTCACGGGFVLDRDGRSCSRIDNS
EYSSHTSSSITFSSYDYRSKEDNNSTIVRRYLNTQPDLLTGILIERCAPGNFGENCKLTC
DNCEHGACTDMADGCICEPGWQGELCDEKCDKEHFGDNCEFRCQCENGGTCDHVTGECKC
PTGVFGDFCEDGCPAGRWGEECEKRCKCGPGGGRCNRKFGACFCAPGRYGKNCHLRCPKF
TFGSGCTEKCSCNKRRSFGCNPVSGKYTCAIGTYGRSCARKCKCAEGVHCHPRSGRCVRK
CPPGRQGLKCQKICSEGYFGQNCQQKCSCSKKNASGCNARSGKCLCKAGFHGSDCSRPCP
AGFFGMGCKSKCTCLNGTCNSEDGSCICSAGFTGPNCERSCHLGTYGQGCAETCHCQGSA
PCDPITGSCLCAAGKTGTYCDRDCPQGTYGVGCAQTCFCQNGAKCDPISGACSCAPGYHG
VVCERPCPDGFWGMSCQNNCNCGNSGSHCDHVTGLCTCSVGYYGDDCLQVCPSGSFGENC
QQICSCGEGATSCDPFTGECQCKSGFTGLKCDKFCERGSWGLRCENRCNCRNGGTCDAQT
GVCQCADGWMGAKCELPCQDGYYGAGCSRTCGCLNGGKCDGDGRCTCLEGYVGDQCQSPC
EDGNWGLQCKNKCKCENGASNSCDNENGKCKCLPGWRGDHCEIACLPGYFGEGCAQKCTC
KSNEPCHHITGQCSCPPGQTGYGCHRVCPNGRFGRDCSQMCACTHENSECSPVDGTCSCS
SGWSGNECEEECPEGRWGPNCSEVCLCSDGGWCDDGKCYCPAGKTGTRCKDVCPKGTWGV
SCLQQCQCGNGGSCDAATGSCSCGVGLTGPTCSRPCPDGTWGSSCKNICHCQWRNTEKCH
AVNGRCYCKAGMTGDHCTEECADGRWGRGCQSRCDCGGYLCDKENGKCFCPPGFMGPKCN
TECTGGNYGPNCSLPCQCEHSSYCAGDTGRCHCRPGWGGPRCQVRISYITR
Download sequence
Identical sequences E4XGM3
GSOIDT00010636001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]