SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E4YEU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E4YEU7
Domain Number 1 Region: 362-478
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000377
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 226-348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000091
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 3 Region: 175-223
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000686
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 4 Region: 142-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 107-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000205
Family EGF-type module 0.032
Further Details:      
 
Weak hits

Sequence:  E4YEU7
Domain Number - Region: 964-1010
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 873-922
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0233
Family Laminin-type module 0.063
Further Details:      
 
Domain Number - Region: 709-799
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0251
Family Growth factor receptor domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E4YEU7
Sequence length 1443
Comment (tr|E4YEU7|E4YEU7_OIKDI) Uncharacterized protein {ECO:0000313|EMBL:CBY34034.1} OX=34765 OS=Oikopleura dioica (Tunicate). GN=GSOID_T00022012001 OC=Oikopleura.
Sequence
MKMRPVQLALAAAALAQQATELRPSDANVCSSTQIVKKQKRQPVVKQADRTKKVWKKNCP
NGQRWCIDYETTKVFYTTFEQVTVDEEVTVYSCCAGWAQGSEAGCTVQVCGAGACFHGGF
CSKDGTTCICKNGWTGTRCERDINECEVGNGQCSHQCCNLVGSYKCSCPQGWLLLSDERT
CADIDECQERNGGCAHQCHNVDGGYQCTCDAGYKLHNDQRSCLPTNRCARDNGNCAQKCI
VLNEHSFKCDCEEGYVLSENGRNCELEDPCLRDNGHCQHNCQSVGQQAVCSCDTGFKLDK
DGQKCIDADECVHNNGGCSGICTNTEGSFFCSCQDGYDVGEDGFTCYKVVIELISRKKPG
RDGCQHSCSEDSGEAICKCRNGFQLEIDGKSCRDVDECATGRHKCQHQCRNIIGSYECSC
RVGFAIARDGVSCEDVNECYDQNGGCDQICNNAQGTYTCACGGGFVLDRDGRSCSRIDNS
EYSSHTSSSITFSSYDYRSKEDNNSTIVRRYLNTQPDLLTGILIERCAPGNFGENCKLTC
NNCEHGACTDMADGCICEPGWQGELCDEKCDKDHFGDNCEFRCQCENGGTCDHVTGECKC
PTGVFGDFCEDGCPAGRWGEECEKRCKCGPGGGRCNRKFGACFCAPGRYGKNCHLRCPKF
TFGSGCTEKCSCNKRRSFGCDPVSGKYTCAIGTYGRSCARKCKCAEGVHCHPRSGRCVRK
CPPGRQGLKCQKICSEGYFGQNCQQKCSCSKKNASGCNAGSGKCLCKAGFHGSDCSRPCP
AGFFGMGCKSKCTCLNGTCNSEDGSCICSAGFTGPNCERSCHLGTYGQGCAETCHCQGSA
PCDPITGSCLCAAGKTGTYCDRDCPQGTYGVGCAQTCFCQNGAKCDPISGACSCAPGYHG
VVCERPCPDGFWGMSCQNNCNCGNSGSHCDHVTGLCTCSVGYYGDDCLQVCPSGSFGENC
QQICSCGEGATSCDPFTGECQCKSGFTGLKCDKFCERGSWGLRCENRCNCRNSGTCDAQT
GVCQCADGWMGSKCELPCQDGYYGAGCSRTCGCLNGGKCDGDGRCTCLEGYVGDQCQSPC
EDGNWGLQCKNKCKCENGASNSCDNENGKCKCLPGWRGDHCEIACLPGYFGEGCAQKCTC
KSNEPCHHITGQCSCPPGQTGYGCHRVCPNGRFGRDCSQMCACTHENSECSPVDGTCSCS
SGWSGNECEEECPEGRWGPNCSEVCLCSDGICDSVTGQCRTCAPGHIGPDCEQRCTSYFW
GSNCAQVRTWGVSCLQQCQCGNGGSCDAATGSCSCGVGLTGPTCSRPCPDGTWGSSCKNI
CHCQWRNTEKCHAVNGRCYCKAGMTGDHCTEECADGRWGRGCQSRCDCGGYLCDKENGKC
FCPPGFMGPKCNTECTGGNYGPNCSLPCQCEHSSYCAGDTGRCHCRPGWGGPRCQVRISY
ITR
Download sequence
Identical sequences E4YEU7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]