SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5A7G7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5A7G7
Domain Number 1 Region: 460-676
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000425
Family Protein kinases, catalytic subunit 0.0069
Further Details:      
 
Domain Number 2 Region: 233-261
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000722
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E5A7G7
Sequence length 851
Comment (tr|E5A7G7|E5A7G7_LEPMJ) Poly(A)-nuclease deadenylation complex subunit 3 {ECO:0000256|HAMAP-Rule:MF_03181} KW=Complete proteome; Reference proteome OX=985895 OS=Av1-4-5-6-7-8) (Blackleg fungus) (Phoma lingam). GN=LEMA_P088010.1 OC=Leptosphaeria maculans species complex.
Sequence
MATPRPSTNCRQWDAPSAAAYSRTPLMGSLSNVQPDISPPTSCASNSTIRLPTIEPVLAD
KGASTAARPASSSQPQKQPHATAIARSASSTANSNSSSELTSSSSRDSLPPAPQARAADS
TPPKPAARDHRRTKPNKTTTKWNRRRRASSDDTGLDSKPPTAHRPKSAHTAVPLQLPAPS
PSPSTPSKQRRQPSITSSTSSTSQTRFMATTFGGPSGDSRRGVVSPRPKGREAKNTFCRN
VTIYGHCRYENTCPYIHDQNKSNQSENAKKRFNVDSPSFTPLQPATNGSVTPSARSAAIS
PKAANAAVFTPKSQRSDWMFIVLGLAVTLHGSSHSPQGDPTGGYDPFNTSNNLSNITSAS
HQAGPINPYAQEATYYQNANAFQTPAYHLYWPVGPQPTGLLAYQRTAHDFFIPDSVREDL
QKRAEVARQTIPNTTLPVIEQFHSLFCLDTSPQKNTAPFGYASWIYKAVSSKDGKTYALR
RLENFRLTSETAIRSAQPWKRVLNGGVVTIHEAFTTRAFGDSSLILVTDYHPNSKSLADE
HFKPIQRFHGRQPTSSHVPEQTLWGYLVQIASALKAIHGSGLAARLITPSKILLTAKNRI
RLNACSIMDIVQFDNARPMAELQADDFVQLGRLILCIANNNASAHLQMQKSMEYVTRSYT
ARLKECIQWLLSPQPVQGTPSSPSTPTPMVKDIDTFLAGIADQFASVFDSELHAHDTLTN
TLGRELESSRLVRLLIKLNMINERPELDASQHVPGSTASGASSVWAETGERYYLKLFRDY
VFHQVDANGHPVTDLAHVLDCLNKLDAGTDEKIALISRDEQNVLIVSYREVKRGLESSFQ
DLIRAGRSSGK
Download sequence
Identical sequences E5A7G7
CBX99562 XP_003843041.1.65998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]