SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E5RIV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E5RIV1
Domain Number 1 Region: 58-192
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.59e-19
Family Carbon-carbon bond hydrolase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E5RIV1
Sequence length 193
Comment (tr|E5RIV1|E5RIV1_HUMAN) Protein NDRG1 {ECO:0000313|Ensembl:ENSP00000428345} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=NDRG1 OC=Catarrhini; Hominidae; Homo.
Sequence
MAVPPPGIMKQAGDSRDMSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGS
VHVTLCGTPKGNRPVILTYHDIGMNHKTCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGA
ASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTGAGAYILTRFALNNPEMVEGLVLI
NVNPCAEGWMDWA
Download sequence
Identical sequences E5RIV1
ENSP00000428345 ENSP00000428345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]