SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6BU71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6BU71
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.28e-48
Family Lambda phage gpU-like 0.000000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6BU71
Sequence length 131
Comment (tr|E6BU71|E6BU71_ECOLX) Phage minor tail protein U {ECO:0000313|EMBL:EFU32192.1} KW=Complete proteome OX=679202 OS=Escherichia coli MS 85-1. GN=HMPREF9350_05995 OC=Enterobacteriaceae; Escherichia.
Sequence
MKHTELRAAVLDALEKHDTGATLFDGRPAVFDEADFPAVAVYLTGAEYTGEELDSDTWQA
ALHIEVFLPAQVPDSELDAWMESRIYPVMNDIPALSDLITSMVASGYDYRRDDDAGLWSS
ADLTYVITYEM
Download sequence
Identical sequences E1JEZ4 E6BU71
WP_000683131.1.23105 WP_000683131.1.40238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]