SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6D6P6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6D6P6
Domain Number 1 Region: 15-226
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.1e-23
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6D6P6
Sequence length 237
Comment (tr|E6D6P6|E6D6P6_CUTAC) Thioesterase domain protein {ECO:0000313|EMBL:EFT63519.1} KW=Complete proteome OX=765080 OS=Propionibacterium acnes HL110PA4. GN=HMPREF9578_00729 OC=Cutibacterium.
Sequence
MNPEFWQRISSATTSCCSTVLIFPPTGAGAPAFQSMSVLEGDTTVWGYCPPGRGQRLLEP
GIRTMGEFVSKFRSSFDIPTGPLILAGVSFGAMLSFVAANILENDGIFATRLVALCGQSP
KSYRGEREGWNLERARQRMRSYGLTPKSILDSDESDDLFVRPTLDDLLLAESCCGNQLKQ
IHVPITCVSAIDDKIVSSEEAVQWREATSETYRLIEVTGGHYAHEGFGRREWLNVFS
Download sequence
Identical sequences E6D6P6
WP_002533165.1.1248 WP_002533165.1.22236 WP_002533165.1.25499 WP_002533165.1.2617 WP_002533165.1.34387 WP_002533165.1.43679 WP_002533165.1.46705 WP_002533165.1.4830 WP_002533165.1.6930 WP_002533165.1.78128 WP_002533165.1.91798 gi|386071214|ref|YP_005986110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]