SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6N6U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6N6U7
Domain Number 1 Region: 5-31
Classification Level Classification E-value
Superfamily RING/U-box 0.0000724
Family RING finger domain, C3HC4 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6N6U7
Sequence length 158
Comment (tr|E6N6U7|E6N6U7_9ARCH) Uncharacterized protein {ECO:0000313|EMBL:BAJ48016.1} KW=Complete proteome; Reference proteome OX=311458 OS=Candidatus Caldiarchaeum subterraneum. GN=CSUB_C0963 OC=Candidatus Caldiarchaeum.
Sequence
MSQEGSWCPNCGAPVELSPDTVVLICGYCGTAVSLTGNTYTLSIVECEDKGVVNNVLEMF
VRERAKGGVLRDVKYLMVPRWVIEVEERRYRDKSSYSEYRPVRGTIRERLAVAVYGKRFE
GLFGLGQVKYILLSRLEAAKPFDAEKVMGWSAIGSELE
Download sequence
Identical sequences E6N6U7
gi|557694392|ref|YP_008797446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]