SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6R4Q7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6R4Q7
Domain Number 1 Region: 25-74,218-302
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.36e-25
Family Regulator of G-protein signaling, RGS 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6R4Q7
Sequence length 417
Comment (tr|E6R4Q7|E6R4Q7_CRYGW) Bud site selection-related protein, putative {ECO:0000313|EMBL:ADV22028.1} KW=Complete proteome; Reference proteome OX=367775 OS=(Filobasidiella gattii) (Cryptococcus bacillisporus). GN=CGB_D7840W OC=Cryptococcus gattii species complex.
Sequence
MAENNEKITAEATTSKHERRTSGTRHLKLSRLPTLQEVLDRRTRPPLDLFCFYIFLQREL
SEDALDFWLDVQQHENLCKAYFKDLRRAGRSIQDEWPEFAEYARANGTHFAPLLSLPSEP
PSPNPASSNIGSHIASPATGTTDFDFSRPSVLDTRVRRDTESHGRPAQHLTLSPTPINIQ
GQGGEQRQNDRQSTAPNQEMSLKGKRKSKAPTVIARDRAIEKNALLESAERIFYRYLFDG
GEREIYLPPSLRVYDFPESISGDVSPLIPDLFHAQKVYVFKALEQDAFPRFLRAKAFANL
TPLGSIVRLVAGLLCLWGAFVLAFSLIFLDYKPRLTRLWLIFPFLFAFLLLLSSYYSLSP
LLFACNVSETTPFHFIRVREQYVRKLIAIRAGIIVGASMLLTAIFVVIFTVVPGHRL
Download sequence
Identical sequences A0A0D0YB71 E6R4Q7
XP_003193815.1.73883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]