SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UA79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  E6UA79
Domain Number - Region: 40-104
Classification Level Classification E-value
Superfamily PA domain 0.0144
Family PA domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6UA79
Sequence length 149
Comment (tr|E6UA79|E6UA79_RUMA7) UPF0178 protein Rumal_1803 {ECO:0000256|HAMAP-Rule:MF_00489} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_1803 OC=Ruminococcus.
Sequence
MRIFIDADGCPVVRLTLDIAKKHEIPVTIVCDTAHEFSRYDAEVITVDKGADSADFALVN
LMEKGDIAVTQDYGLAAMCLAKKAYAINQNGLVYNSDNIDSLLMSRHIAKKLKRSGNHLK
GPAKRTSDNDKKFVAALENLITETFGKDG
Download sequence
Identical sequences E6UA79
gi|317056468|ref|YP_004104935.1| WP_013498465.1.49193 WP_013498465.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]