SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UBZ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UBZ7
Domain Number 1 Region: 227-285
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000017
Family Type I dockerin domain 0.0022
Further Details:      
 
Domain Number 2 Region: 85-151
Classification Level Classification E-value
Superfamily L domain-like 0.00000255
Family Ngr ectodomain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6UBZ7
Sequence length 290
Comment (tr|E6UBZ7|E6UBZ7_RUMA7) Uncharacterized protein {ECO:0000313|EMBL:ADU21548.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_1022 OC=Ruminococcus.
Sequence
MMNKRIIAGLMCLSLAFCAVVCPGAADKALIPSAAQADTIDDGVFVYGLTDDRTGVKVIE
TATWPYEGRILESADIPSVVRGLPVKEIGAGCFASYTRLEKVTLPDSIEVIGDRAFFDCR
SLNTIRMPAKLKKIGQSAFMFMNLKTIVLPDGCKEIGSKAFYENDGLTVTIPDSVTVINE
NAFQGTENVTIKAHKGSYAEKFVTVNNKRAEKLEFTYPITFVEINYSTVKGDISGDGKVD
ITDIAKLSAHIKSKKYVTDIGSADINGDGIINISDLTVIAAHIKGKRAMK
Download sequence
Identical sequences E6UBZ7
gi|317055715|ref|YP_004104182.1| WP_013497726.1.49193 WP_013497726.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]