SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UEB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UEB2
Domain Number 1 Region: 103-159
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000265
Family Type I dockerin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) E6UEB2
Sequence length 164
Comment (tr|E6UEB2|E6UEB2_RUMA7) Uncharacterized protein {ECO:0000313|EMBL:ADU23502.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_3037 OC=Ruminococcus.
Sequence
MKKVTAIAAAIVLSAGLAVAIIPSFGALAEGDDVIELPILPIGNSSAADDTSRTDIPDSS
SPNNECSEISTPESHPYDDGGSGNDNLADSIFDSEIDDKKEPVKGDLNGDRIVNVTDLSR
LAAYIKGKKDLPFPDAADINNSGKIDVTDLSKLAAHIKGKKFLG
Download sequence
Identical sequences E6UEB2
WP_013499611.1.49193 WP_013499611.1.63498 gi|317057669|ref|YP_004106136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]