SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UFX8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UFX8
Domain Number 1 Region: 110-330
Classification Level Classification E-value
Superfamily L domain-like 8.75e-25
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 384-441
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000000598
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6UFX8
Sequence length 444
Comment (tr|E6UFX8|E6UFX8_RUMA7) Dockerin type 1 {ECO:0000313|EMBL:ADU23652.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_3189 OC=Ruminococcus.
Sequence
MYNVKYYYILIICKKQVRIEYKRKESGFMKMKRVATGLCALMMVFGGAVVPVVPIGTDTV
VNASADSVYGSFNYIVFGDNTVEITGYNGSAANVSVPSSINGKTVVSIGKYAFDNNHSVK
SVTLPSTIKSIGICAFFYCANLQSINLPSGLKEIKEEAFMNCISLRSVAMPNTVTKLESS
AFCGCESLSSLTISSGLKAIPDYAFEECGALRNVTVPSGVTKLGIHAFGKCKGLESISLP
STLTFIGANAFYLCSRLKSISLPDNITSIEANTFIDCVGLASVKFPSKLKEISIDAFNGC
ISLRNVQLPSSLTTIWYDAFYGCTAMGTVTIPKSVTKISPDALGFYDNGKIKGFKMRVYK
GSAAEQYAKENGLAYEVISTASKSKGDINGDGSVNVSDISKVAAHIKGKKTLGTSNKADL
NGDGRVNVSDISLLSAYVKGKKKF
Download sequence
Identical sequences E6UFX8
gi|317057819|ref|YP_004106286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]