SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UI45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UI45
Domain Number 1 Region: 243-355
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.08e-21
Family N-acetyl transferase, NAT 0.0067
Further Details:      
 
Domain Number 2 Region: 31-80,115-192
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000602
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6UI45
Sequence length 360
Comment (tr|E6UI45|E6UI45_RUMA7) GCN5-related N-acetyltransferase {ECO:0000313|EMBL:ADU21298.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_0763 OC=Ruminococcus.
Sequence
MDVIEEIRALAEEYEACGGTERSDGSKSRLFDPPATIEQVREFEKEMRVTLPEVFVLYLT
ELGNGGIGPNYGIYSLDKMRERNPNAAARAELPVMIGGRLPEEAWKTFAREAEAADDEED
FDKIEELEQRLIAGGIFISTPGCTMYTLLMCRGEAAGDVCTIDFDYLTWYDKPIEGGYSF
EDWMIEGMHDHIARRKYGIDIEMVTRYNQRGLGMAGEKLTDSLIDLRIAQLTEEGDTDAV
NLSHELRDFYERAFGNGTFRMWIAVHRGEVIGTVGLTMLEKPPYSANPNGKIGLISSMYV
KPEFRRRGMAKCMLGYVMRWAKRNGMGIVQAMASEQGVKLYESCGFRHSERFLQYDLKNM
Download sequence
Identical sequences E6UI45
gi|317055465|ref|YP_004103932.1| WP_013497481.1.49193 WP_013497481.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]