SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UK81 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UK81
Domain Number 1 Region: 75-135
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000343
Family Type I dockerin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6UK81
Sequence length 139
Comment (tr|E6UK81|E6UK81_RUMA7) Uncharacterized protein {ECO:0000313|EMBL:ADU24077.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_3638 OC=Ruminococcus.
Sequence
MKIIAQKTLTIYVNSSYAIYGQTLADVTLPTADDGTWAWEDDTLSVGDVGNNTFAATYTP
EDTDNYNTLSQDLTVTLLGDINFDGKINVTDIVKIAAHIKGKKILDKTAARAADVNGDSS
IDVTDIIMIAAHIKGKKLL
Download sequence
Identical sequences E6UK81
gi|317134052|ref|YP_004089963.1|NC_014824 WP_013483625.1.49193 WP_013483625.1.63498 gi|317134052|ref|YP_004089963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]