SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6UKK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6UKK5
Domain Number 1 Region: 65-115
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000051
Family Type I dockerin domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E6UKK5
Sequence length 121
Comment (tr|E6UKK5|E6UKK5_RUMA7) Uncharacterized protein {ECO:0000313|EMBL:ADU24201.1} KW=Complete proteome; Reference proteome OX=697329 OS=2250 / 7). GN=Rumal_3766 OC=Ruminococcus.
Sequence
MNGFVKKIAGIMSAVVCMGSAVVSAYAAPVLTDEDARVCSTVVEVKPELVEETERAVFVA
EVSEKGDINGDNVINVVDVAALAAHIKGDKIIDTDAADINSDGFVNITDLSLLSVKVKGN
G
Download sequence
Identical sequences E6UKK5
gi|319788772|ref|YP_004090087.1|NC_014825 gi|319788772|ref|YP_004090087.1| WP_013483746.1.49193 WP_013483746.1.63498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]