SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6WRS6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6WRS6
Domain Number 1 Region: 10-276
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.81e-28
Family Aclacinomycin methylesterase RdmC 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6WRS6
Sequence length 282
Comment (tr|E6WRS6|E6WRS6_PSEUU) Uncharacterized protein {ECO:0000313|EMBL:ADV26875.1} KW=Complete proteome; Reference proteome OX=743721 OS=Pseudoxanthomonas suwonensis (strain 11-1). GN=Psesu_1025 OC=Xanthomonadaceae; Pseudoxanthomonas.
Sequence
MSQSRTSEQSVSASDAHRWTLASVAPAEPRARLLWLPALGVAARHYLPLAEALAGLGIAV
HLHEWRGNGSSSLRPSRAQDWGYAELLTRDLPASLAAIPNNVPTWIGGHSLGGQLACCFA
GLQPARIAGLALVASGTPYWKTFPTPLRWLLPLAYRLLPWLARRQGVLHGRRLGFGGTEA
HSLIADWAAVGRSGRYAAAGADIDLEAGMAALRIPVVAVAMDEDWLGPASSLRGLLAHLP
RSKADVHHMDHAALGVRADHFGWMRTPAAVAAALAEKICEPS
Download sequence
Identical sequences E6WRS6
WP_013534705.1.97407 gi|319786631|ref|YP_004146106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]