SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6XKE0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6XKE0
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.7e-45
Family SMI1/KNR4-like 0.00000534
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6XKE0
Sequence length 135
Comment (tr|E6XKE0|E6XKE0_SHEP2) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:ADV53259.1} KW=Complete proteome OX=399804 OS=Shewanella putrefaciens (strain 200). GN=Sput200_0780 OC=Shewanellaceae; Shewanella.
Sequence
MHDIIEQLQERSESVPVPLELPTFEQLVEVEEQILISLPRELKEYLLYASDVIYGAIEPV
TVADPYSHTYLPEVTCYAWSIGMPRDMIAICQMGDDFYCIDQEGQVHFWKNGDFADIYWE
SFWEWVEDIWLKNKY
Download sequence
Identical sequences A4Y3I6 E6XKE0
319224.Sputcn32_0789 351745.Sputw3181_3386 WP_011790641.1.65999 WP_011790641.1.82224 WP_011790641.1.85280 WP_011790641.1.98421 gi|386312560|ref|YP_006008725.1| gi|146291894|ref|YP_001182318.1| gi|120600178|ref|YP_964752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]