SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E6XM69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E6XM69
Domain Number 1 Region: 3-66,103-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000157
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E6XM69
Sequence length 153
Comment (tr|E6XM69|E6XM69_SHEP2) Cell wall assembly/cell proliferation coordinating protein, KNR4-like protein {ECO:0000313|EMBL:ADV55620.1} KW=Complete proteome OX=399804 OS=Shewanella putrefaciens (strain 200). GN=Sput200_3225 OC=Shewanellaceae; Shewanella.
Sequence
MKISELQKERGIELPSDYLEFVAGIDAGEDYCFNKFPDEYPDFEGRCWAFFDEELLCENI
EMSGVGNAPAHRQLELYLKCYREFSNSEFVHSSEGKLPINRVANGFVVAEENGDLLYLDP
EDNFSVWIFHHDGSDVKKVSNSMSEWLARTTTA
Download sequence
Identical sequences A4YA44 E6XM69
319224.Sputcn32_3115 WP_011919918.1.82224 WP_011919918.1.85280 gi|146294202|ref|YP_001184626.1| gi|386314921|ref|YP_006011086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]