SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7CYG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7CYG2
Domain Number 1 Region: 127-371
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.37e-71
Family Nuclear receptor ligand-binding domain 0.000000000603
Further Details:      
 
Domain Number 2 Region: 17-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-28
Family Nuclear receptor 0.00000495
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7CYG2
Sequence length 373
Comment (tr|E7CYG2|E7CYG2_XENTR) Thyroid hormone receptor beta type 1 isoform a {ECO:0000313|EMBL:ADL74876.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=thrb OC=Silurana.
Sequence
MPSSMSGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYE
GKCVIDKVTRNQCQECRFKKCIAVGMATDLVLDDSKRLAKRKLIEENREKRRKDEIQKSL
VQKPEPTQEEWELIQVVSEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEA
FSQFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETL
TLNGEMAVTRGQLKNGGLGVVSDAIFDLGVSLSSFSLDDTEVALLQAVLLMSSDRPGLTS
VERIEKCQEGFLLAFEHYINYRKHNIAHFWPKLLMKVTDLRMIGACHASRFLHMKVECPT
ELFPPLFLEVFED
Download sequence
Identical sequences E7CYG2
gi|302954142|gb|ADL74876|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]