SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7EU85 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7EU85
Domain Number 1 Region: 131-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000496
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000179
Further Details:      
 
Domain Number 2 Region: 199-285
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7EU85
Sequence length 454
Comment (tr|E7EU85|E7EU85_HUMAN) Fragile X mental retardation syndrome-related protein 1 {ECO:0000313|Ensembl:ENSP00000420515} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FXR1 OC=Catarrhini; Hominidae; Homo.
Sequence
MMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKTVKKNTFFKCTVDVPEDLREACANEN
AHKDFKKAVGACRIFYHPETTQLMILSASEATVKRVNILSDMHLRSIRTKLMLMSRNEEA
TKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSNIQQARKVPGVTAIELDEDTGTFRIY
GESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKNGKVIQEIVDKSGVVRVRIEGDNENK
LPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKEVEQLRMERLQIDEQLRQIGSRSYSG
RGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDWSLAGEDDRDSRHQRDSRRRPGGR
GRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLLDNTESDQTADTDASESHHSTNRRRR
SRRRRTDEDAVLMDGMTESDTASVNENGLGKRCD
Download sequence
Identical sequences A0A2J8L6W2 A0A2J8WGW0 E7EU85 F7I1J4
ENSCJAP00000023572 XP_010335900.1.74449 XP_016862790.1.92137 ENSP00000420515 ENSP00000420515 ENSMMUP00000038775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]