SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7EZC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7EZC5
Domain Number 1 Region: 377-559
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-62
Family SPRY domain 0.0000324
Further Details:      
 
Domain Number 2 Region: 10-80
Classification Level Classification E-value
Superfamily RING/U-box 8.32e-20
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 3 Region: 161-227
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000214
Family B-box zinc-binding domain 0.00061
Further Details:      
 
Weak hits

Sequence:  E7EZC5
Domain Number - Region: 286-334
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0392
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) E7EZC5
Sequence length 568
Comment (tr|E7EZC5|E7EZC5_DANRE) Si:dkey-46i9.6 {ECO:0000313|Ensembl:ENSDARP00000111607} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=si:dkey-46i9.6 OC=Cyprinidae; Danio.
Sequence
MASPSSMLAEEQVHCSICLDVFTNPVSIPCGHNFCMACIGSYWKSSALFMCPMCKKTFFK
QPDISINTVLREIAEKFKEMKRNPIVSLQSATQPDPTPSPVELPIEMPELIPPNAPWAQE
VSCDVCTGPQRRAVKSCLVCLTSYCEEHLKTHTVRFTKHKLIEPVLNLEDRMCKKHERLL
ELFCKKDQTIVCVLCTEMEHRAHYTIPVEREWAEKKALLRKTESEVQQMIQDRLKKVDEI
KHSIELNKSGAQREVEDSMQVFSDLIRALQKAQAELVLDIEEKQRKTESRANEQIQELEQ
EITVLKTRNEELEYLSHTEDHIHFLQNFPSLMSHPHTKDWSEICVHADPCVGTIRRAVLK
LEETLTEEVEKLAEAELRRVQKYSVDVTFDPDTANPWLQLSEDGHQIRHLGSWQDLRDAP
ERFDTVVIALGRQGFCSGRRYWEVQVGEKDDWYLGVARGSVNRKGRISVSTTQGYWALAM
KKGQEYRVSSSPPLLVSVEHKLKRVGVYVDYEEGQVSFYDVQNKSHIYTFMDTFKEKLFP
FFYLYCCDKASDTMIICPVQETPHTKQC
Download sequence
Identical sequences E7EZC5
XP_700683.4.45394 ENSDARP00000111607 ENSDARP00000111607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]