SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for E7F2S0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  E7F2S0
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.04e-22
Family Synaptotagmin-like (S variant) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) E7F2S0
Sequence length 269
Comment (tr|E7F2S0|E7F2S0_DANRE) Regulating synaptic membrane exocytosis 4 {ECO:0000313|Ensembl:ENSDARP00000077256} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=rims4 OC=Cyprinidae; Danio.
Sequence
MERSQSRLSLSASFEALAIYFPCMNSFDEDDGDPEGRRLKGIQRSTETGLAVEMPSRTVR
QASHESIEDSMNSYGSEGNLNYSGMCLASDAQFSDFLDGMGPAQFVGRQTLATTSMGDVE
ISLMERSGQLEVEVIQARGLIMKPGSKGPPAAYIKVYLLENGICIAKKKTKSVRKSLDPL
YNQVLVFSESPQGKVVQVIVWGNYGRMDRKCFMGVARILLEELDLSSMVIGWYKLFPTSS
MVDPTMAPLIRHSSQLSLESTVGPCCERS
Download sequence
Identical sequences E7F2S0
ENSDARP00000077256 XP_699547.4.45394 ENSDARP00000077256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]